RegulonDB RegulonDB 10.9: Amino acid Sequence
cold shock protein CspG Amino Acid Sequence


Size: 70

Fasta

 

>cold shock protein CspG E. coli K12. Version NC_000913.3 GI:556503834
MSNKMTGLVKWFNADKGFGFITPDDGSKDVFVHFTAIQSNEFRTLNENQKVEFSIEQGQR
GPAAANVVTL
              
                            

Download fasta file
RegulonDB