RegulonDB RegulonDB 10.9: Amino acid Sequence
putative aminoacrylate peracid reductase RutC Amino Acid Sequence


Size: 128

Fasta

 

>putative aminoacrylate peracid reductase E. coli K12. Version NC_000913.3 GI:556503834
MPKSVIIPAGSSAPLAPFVPGTLADGVVYVSGTLAFDQHNNVLFADDPKAQTRHVLETIR
KVIETAGGTMADVTFNSIFITDWKNYAAINEIYAEFFPGDKPARFCIQCGLVKPDALVEI
ATIAHIAK
              
                            

Download fasta file
RegulonDB