RegulonDB RegulonDB 10.8: Amino acid Sequence
pyrimidine monooxygenase RutA Amino Acid Sequence


Size: 382

Fasta

 

>pyrimidine oxygenase E. coli K12. Version NC_000913.3 GI:556503834
MQDAAPRLTFTLRDEERLMMKIGVFVPIGNNGWLISTHAPQYMPTFELNKAIVQKAEHYH
FDFALSMIKLRGFGGKTEFWDHNLESFTLMAGLAAVTSRIQIYATAATLTLPPAIVARMA
ATIDSISGGRFGVNLVTGWQKPEYEQMGIWPGDDYFSRRYDYLTEYVQVLRDLWGTGKSD
FKGDFFTMNDCRVSPQPSVPMKVICAGQSDAGMAFSARYADFNFCFGKGVNTPTAFAPTA
ARMKQAAEQTGRDVGSYVLFMVIADETDDAARAKWEHYKAGADEEALSWLTEQSQKDTRS
GTDTNVRQMADPTSAVNINMGTLVGSYASVARMLDEVASVPGAEGVLLTFDDFLSGIETF
GERIQPLMQCRAHLPALTQEVA
              
                            

Download fasta file
RegulonDB