RegulonDB RegulonDB 10.10: Amino acid Sequence
poly-N-acetyl-D-glucosamine synthase subunit PgaC Amino Acid Sequence


Size: 441

Fasta

 

>poly-N-acetyl-D-glucosamine synthase subunit PgaC E. coli K12. Version NC_000913.3 GI:556503834
MINRIVSFFILCLVLCIPLCVAYFHSGELMMRFVFFWPFFMSIMWIVGGVYFWVYRERHW
PWGENAPAPQLKDNPSISIIIPCFNEEKNVEETIHAALAQRYENIEVIAVNDGSTDKTRA
ILDRMAAQIPHLRVIHLAQNQGKAIALKTGAAAAKSEYLVCIDGDALLDRDAAAYIVEPM
LYNPRVGAVTGNPRIRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTVSGVIAAFRRS
ALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGG
AEVFLKNMTRLWRKENFRMWPLFFEYCLTTIWAFTCLVGFIIYAVQLAGVPLNIELTHIA
ATHTAGILLCTLCLLQFIVSLMIENRYEHNLTSSLFWIIWFPVIFWMLSLATTLVSFTRV
MLMPKKQRARWVSPDRGILRG
              
                            

Download fasta file
RegulonDB