RegulonDB RegulonDB 11.0: Amino acid Sequence
chaperone protein YcdY Amino Acid Sequence


Size: 184

Fasta

 

>chaperone protein YcdY E. coli K12. Version NC_000913.3 GI:556503834
MNEFSILCRVLGSLYYRQPQDPLLVPLFTLIREGKLAANWPLEQDELLTRLQKSCDMTQV
SADYNALFIGDECAVPPYRSAWVEGATEAEVRAFLSERGMPLADTPADHIGTLLLAASWL
EDQSTEDESEALETLFSEYLLPWCGAFLGKVEAHATTPFWRTMAPLTRDAISAMWDELEE
DSEE
              
                            

Download fasta file
RegulonDB