RegulonDB RegulonDB 10.9: Amino acid Sequence
2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity Amino Acid Sequence


Size: 177

Fasta

 

>2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity E. coli K12. Version NC_000913.3 GI:556503834
MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC
PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA
ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQGDE
              
                            

Download fasta file
RegulonDB