RegulonDB RegulonDB 10.9: Amino acid Sequence
osmoregulated periplasmic glucans biosynthesis protein C Amino Acid Sequence


Size: 385

Fasta

 

>protein required for succinyl modification of osmoregulated periplasmic glucans E. coli K12. Version NC_000913.3 GI:556503834
MNPVPAQREYFLDSIRAWLMLLGIPFHISLIYSSHTWHVNSAESSLWLTLFNDFIHSFRM
QVFFVISGYFSYMLFLRYPLKKWWKVRVERVGIPMLTAIPLLTLPQFIMLQYVKGKAESW
PGLSLYDKYNTLAWELISHLWFLLVLVVMTTLCVWIFKRIRNNLENSDKTNKKFSMVKLS
VIFLCLGIGYAVIRRTIFIVYPPILSNGMFNFIVMQTLFYLPFFILGALAFIFPHLKALF
TTPSRGCTLAAALAFVAYLLNQRYGSGDAWMYETESVITMVLGLWMVNVVFSFGHRLLNF
QSARVTYFVNASLFIYLVHHPLTLFFGAYITPHITSNWLGFLCGLIFVVGIAIILYEIHL
RIPLLKFLFSGKPVVKRENDKAPAR
              
                            

Download fasta file
RegulonDB