RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2770 domain-containing protein YceO Amino Acid Sequence


Size: 46

Fasta

 

>DUF2770 domain-containing protein YceO E. coli K12. Version NC_000913.3 GI:556503834
MRPFLQEYLMRRLLHYLINNIREHLMLYLFLWGLLAIMDLIYVFYF
              
                            

Download fasta file
RegulonDB