RegulonDB RegulonDB 10.9: Amino acid Sequence
regulator of biofilm formation Amino Acid Sequence


Size: 84

Fasta

 

>regulator of biofilm formation E. coli K12. Version NC_000913.3 GI:556503834
MEKNNEVIQTHPLVGWDISTVDSYDALMLRLHYQTPNKSEQEGTEVGQTLWLTTDVARQF
ISILEAGIAKIESGDFQVNEYRRH
              
                            

Download fasta file
RegulonDB