RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA damage-inducible protein I Amino Acid Sequence


Size: 81

Fasta

 

>DNA damage-inducible protein I E. coli K12. Version NC_000913.3 GI:556503834
MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNLSVIGATKEDK
QRISEILQETWESADDWFVSE
              
                            

Download fasta file
RegulonDB