RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1425 domain-containing protein YcfL Amino Acid Sequence


Size: 125

Fasta

 

>DUF1425 domain-containing protein YcfL E. coli K12. Version NC_000913.3 GI:556503834
MRKGCFGLVSLVLLLLVGCRSHPEIPVNDEQSLVMESSLLAAGISAEKPFLSTSDIQPSA
SSTLYNERQEPVTVHYRFYWYDARGLEMHPLERPRSVTIPAHSAVTLYGSANFLGAHKVR
LYLYL
              
                            

Download fasta file
RegulonDB