RegulonDB RegulonDB 10.9: Amino acid Sequence
N-acetyl-D-glucosamine kinase Amino Acid Sequence


Size: 303

Fasta

 

>N-acetyl-D-glucosamine kinase E. coli K12. Version NC_000913.3 GI:556503834
MYYGFDIGGTKIALGVFDSGRQLQWEKRVPTPRDSYDAFLDAVCELVAEADQRFGCKGSV
GIGIPGMPETEDGTLYAANVPAASGKPLRADLSARLDRDVRLDNDANCFALSEAWDDEFT
QYPLVMGLILGTGVGGGLIFNGKPITGKSYITGEFGHMRLPVDALTMMGLDFPLRRCGCG
QHGCIENYLSGRGFAWLYQHYYHQPLQAPEIIALYDQGDEQARAHVERYLDLLAVCLGNI
LTIVDPDLVVIGGGLSNFPAITTQLADRLPRHLLPVARVPRIERARHGDAGGMRGAAFLH
LTD
              
                            

Download fasta file
RegulonDB