RegulonDB RegulonDB 10.9: Amino acid Sequence
e14 prophage; putative protein YmfH Amino Acid Sequence


Size: 103

Fasta

 

>e14 prophage; putative protein YmfH E. coli K12. Version NC_000913.3 GI:556503834
MVNAAQRTRVKVEADNRPSVDTHPPGVQPSPGTGGTRHHNFMLCVVLAVPVFSLVLSGTA
LFTKQRRVSPDDGLITRPILIAVATGALLCFVEKLTDRAGSIC
              
                            

Download fasta file
RegulonDB