RegulonDB RegulonDB 10.9: Amino acid Sequence
e14 prophage; putative DNA-binding transcriptional regulator YmfT Amino Acid Sequence


Size: 66

Fasta

 

>e14 prophage; putative DNA-binding transcriptional regulator YmfT E. coli K12. Version NC_000913.3 GI:556503834
MKAYWDSLTKEQQGELAGKVGSTPGYLRLVFNGYKKASFVLAKKLEQYTSGAITKSDLRP
DIYPKD
              
                            

Download fasta file
RegulonDB