RegulonDB RegulonDB 10.9: Amino acid Sequence
e14 prophage; putative protein JayE Amino Acid Sequence


Size: 263

Fasta

 

>e14 prophage; putative protein JayE E. coli K12. Version NC_000913.3 GI:556503834
MWYMRWEGVSDGLKVTAGSVIQRDDLVQYTTTDDATSSGGVLRVPIACSSAGAVGNADDG
TALILVTPVNGLPSSGVADTLTGGFDTEELETWRARVIERYYWTPQGGADGDYVVWAKEV
PGITRAWTYRHLMGTGTVGVMIASSDLINPIPEESTETAARQHIGPLAPVAGSDLYVFRP
VAHTVDFHIRVTPDTPEIRAAITAELRSFLLRDGYPQGELKVSRISEAISGANGEYSHQL
LAPVDNISIAKNELAVLGTISWT
              
                            

Download fasta file
RegulonDB