RegulonDB RegulonDB 10.9: Amino acid Sequence
e14 prophage; DUF2313 domain-containing protein YmfQ Amino Acid Sequence


Size: 194

Fasta

 

>e14 prophage; DUF2313 domain-containing protein YmfQ E. coli K12. Version NC_000913.3 GI:556503834
MDVTNDDYIRLLSALLPPGPVWSASDPAIAGAAPSLTRVHQRADALMRELDPRTTTELIN
RWERLCGLPDECIPAGTQTLRQRQQRLDAKVNLAGGINEDFYLAQLAALGRPDATITRYD
KSTFTCSSACTDAVNAPEWRYYWQVNMPATTNSTWMTCGDPCDSALRIWGDTVVECVLNK
LCPSHTYVIFKYPE
              
                            

Download fasta file
RegulonDB