RegulonDB RegulonDB 10.9: Amino acid Sequence
anti-adaptor protein IraM, inhibitor of σS proteolysis Amino Acid Sequence


Size: 107

Fasta

 

>anti-adaptor protein IraM, inhibitor of σS proteolysis E. coli K12. Version NC_000913.3 GI:556503834
MKWIVIDTVIQPTCGISFSAIWGNMKMIIWYQSTIFLPPGSIFTPVKSGIILKDKEYPIT
IYHIAPFNKDLWSLLKSSQECPPGESKITNKCLHNSCIIKICPYGLK
              
                            

Download fasta file
RegulonDB