RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1398 domain-containing protein YcgX Amino Acid Sequence


Size: 134

Fasta

 

>DUF1398 domain-containing protein YcgX E. coli K12. Version NC_000913.3 GI:556503834
MDQVVVFQKMFEQVRKEQNFSWFYSELKHHRIAHYIYYLATDNIRIITHDDTVLLLRGTR
NLLKVSTTKNPAKIKEAALLHICGKSTFREYCSTLAGAGVFRWVTDVNHNKRSYYAIDNT
LLYIEDVENNKPLI
              
                            

Download fasta file
RegulonDB