RegulonDB RegulonDB 10.9: Amino acid Sequence
blue light- and temperature-regulated antirepressor BluF Amino Acid Sequence


Size: 403

Fasta

 

>blue light-responsive regulator of BluR E. coli K12. Version NC_000913.3 GI:556503834
MLTTLIYRSHIRDDEPVKKIEEMVSIANRRNMQSDVTGILLFNGSHFFQLLEGPEEQVKM
IYRAICQDPRHYNIVELLCDYAPARRFGKAGMELFDLRLHERDDVLQAVFDKGTSKFQLT
YDDRALQFFRTFVLATEQSTYFEIPAEDSWLFIADGSDKELDSCALSPTINDHFAFHPIV
DPLSRRIIAFEAIVQKNEDSPSAIAVGQRKDGEIYTADLKSKALAFTMAHALELGDKMIS
INLLPMTLVNEPDAVSFLLNEIKANALVPEQIIVEFTESEVISRFDEFAEAIKSLKAAGI
SVAIDHFGAGFAGLLLLSRFQPDRIKISQELITNVHKSGPRQAIIQAIIKCCTSLEIQVS
AMGVATPEEWMWLESAGIEMFQGDLFAKAKLNGIPSIAWPEKK
              
                            

Download fasta file
RegulonDB