RegulonDB RegulonDB 10.9: Amino acid Sequence
putative transporter component, N-terminal fragment Amino Acid Sequence


Size: 881

Fasta

 

>putative transporter component, N-terminal fragment E. coli K12. Version NC_000913.3 GI:556503834
MKLKKLPGFSLGLIALAVGNAYATQLLDDYSIISYMTDEESPIEIKDNNPISNGEYLTTE
DESHAVKVDDGVTGYINNASVMTSGDGSYGISVDSQNKVLYISDSDIKTSGSVSDKENGG
ITASAVVSEFGGTIFMNGDNSVESGGAYSAGLLSQVNDSEKMVNNTRLETTDKTNIVTSG
ENAVGVLACSSPGESRTCVDAVDDEVSDSNSYEVISRADLKMNGGSITTNGINSYGAYAN
GKKAYINLDYVALETVADGSYAVAIRQGNIDIKNSSITTTGTKAPIAKIYNGGELFFSNV
TAVSKQDKGISIDASNIDSQAKIALLSVELSSALDSIDVNKTTTDVSILNRSIITPGNNV
LVNNTGGDLNIISSDSILNGATKLVSGTTTLKLSENTIWNMKDDSVVTHLTNSDSIINLS
YDDGQTFTQGKTLTVKGNYVGNNGQLNIRTVLGDDKSATDRLIVEGNTSGSTTVYVKNAG
GSGAATLNGIELITVNGDESPADAFR*GDARIAAGAFEYQLKQQGKNWYLTSYQSVNEED
NSSEGNSESTETPTPVLRPEAGSYVANLAAANTLFVMRLNDRAGETRYIDPVTEQERSSR
LWLRQIGGHNAWRDSNGQLRTTSHRYVSQLGGDLLTGGFTDSDSWRLGVMAGYARDYNLT
HSSVSDYRSKGSVRGYSAGLYATWFADDISKKGAYIDSWAQYSWFKNSVKGDELAYESYS
AKGATVSLEAGYGFALNKSFGLEAAKYTWIFQPQAQAIWMGVDHNAHTEANGSRIENDAN
NNIQTRLGFRTFIRTQEKNSGPHGDDFEPFVEMNWIHNSKDFAVSMNGVKVEQDGASNLG
EIKLGVNGNLNPAASVWGMWACSWVIMATMTPQ*WWA*NIS
              
                            

Download fasta file
RegulonDB