RegulonDB RegulonDB 10.9: Amino acid Sequence
PF16456 family protein YmgD Amino Acid Sequence


Size: 109

Fasta

 

>PF16456 family protein YmgD E. coli K12. Version NC_000913.3 GI:556503834
MKKFALLAGLFVFAPMTWAQDYNIKNGLPSETYITCAEANEMAKTDSAQVAEIVAVMGNA
SVASRDLKIEQSPELSAKVVEKLNQVCAKDPQMLLITAIDDTMRAIGKK
              
                            

Download fasta file
RegulonDB