RegulonDB RegulonDB 10.9: Amino acid Sequence
PF05666 family protein YcgJ Amino Acid Sequence


Size: 122

Fasta

 

>PF05666 family protein YcgJ E. coli K12. Version NC_000913.3 GI:556503834
MNMMRIFYIGLSGVGMMFSSMASGNDAGGLQSPACGVVCDPYICVNSDGISPELTRKYLG
EKAAENLQSLQGYDPSEFTFANGVFCDVKEKLCRDDRYFGVDGKRSGKINQTTTKMLFMC
RE
              
                            

Download fasta file
RegulonDB