RegulonDB RegulonDB 10.9: Amino acid Sequence
inhibitor of g-type lysozyme Amino Acid Sequence


Size: 133

Fasta

 

>inhibitor of g-type lysozyme E. coli K12. Version NC_000913.3 GI:556503834
MKIKSIRKAVLLLALLTSTSFAAGKNVNVEFRKGHSSAQYSGEIKGYDYDTYTFYAKKGQ
KVHVSISNEGADTYLFGPGIDDSVDLSRYSPELDSHGQYSLPASGKYELRVLQTRNDARK
NKTKKYNVDIQIK
              
                            

Download fasta file
RegulonDB