RegulonDB RegulonDB 10.9: Amino acid Sequence
PF05166 family protein YcgL Amino Acid Sequence


Size: 108

Fasta

 

>PF05166 family protein YcgL E. coli K12. Version NC_000913.3 GI:556503834
MPKPGILKSKSMFCVIYRSSKRDQTYLYVEKKDDFSRVPEELMKGFGQPQLAMILPLDGR
KKLVNADIEKVKQALTEQGYYLQLPPPPEDLLKQHLSVMGQKTDDTNK
              
                            

Download fasta file
RegulonDB