RegulonDB RegulonDB 10.8: Amino acid Sequence
hemolysin E Amino Acid Sequence


Size: 303

Fasta

 

>hemolysin E E. coli K12. Version NC_000913.3 GI:556503834
MTEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASV
LVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVL
DDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAG
AAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAK
LKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHGKKTLFEV
PEV
              
                            

Download fasta file
RegulonDB