RegulonDB RegulonDB 10.8: Amino acid Sequence
putative K+:H+ antiporter Amino Acid Sequence


Size: 578

Fasta

 

>putative K+:H+ antiporter E. coli K12. Version NC_000913.3 GI:556503834
MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
SNISWMFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTTA
LEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIAI
PALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLEN
ARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVYQ
LSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPALG
KLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGAA
PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES
              
                            

Download fasta file
RegulonDB