RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar brake protein YcgR Amino Acid Sequence


Size: 244

Fasta

 

>flagellar brake protein YcgR E. coli K12. Version NC_000913.3 GI:556503834
MSHYHEQFLKQNPLAVLGVLRDLHKAAIPLRLSWNGGQLISKLLAITPDKLVLDFGSQAE
DNIAVLKAQHITITAETQGAKVEFTVEQLQQSEYLQLPAFITVPPPTLWFVQRRRYFRIS
APLHPPYFCQTKLADNSTLRFRLYDLSLGGMGALLETAKPAELQEGMRFAQIEVNMGQWG
VFHFDAQLISISERKVIDGKNETITTPRLSFRFLNVSPTVERQLQRIIFSLEREAREKAD
KVRD
              
                            

Download fasta file
RegulonDB