RegulonDB RegulonDB 11.0: Amino acid Sequence
SirB family protein YchQ Amino Acid Sequence


Size: 130

Fasta

 

>SirB family protein YchQ E. coli K12. Version NC_000913.3 GI:556503834
MTSFSTLLSVHLISIALSVGLLTLRFWLRYQKHPQAFARWTRIVPPVVDTLLLLSGIALM
AKAHILPFSGQAQWLTEKLFGVIIYIVLGFIALDYRRMHSQQARIIAFPLALVVLYIIIK
LATTKVPLLG
              
                            

Download fasta file
RegulonDB