RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF440 domain-containing protein YciU Amino Acid Sequence


Size: 109

Fasta

 

>DUF440 domain-containing protein YciU E. coli K12. Version NC_000913.3 GI:556503834
MDMDLNNRLTEDETLEQAYDIFLELAADNLDPADVLLFNLQFEERGGAELFDPAEDWQEH
VDFDLNPDFFAEVVIGLADSEDGEINDVFARILLCREKDHKLCHIIWRE
              
                            

Download fasta file
RegulonDB