RegulonDB RegulonDB 10.9: Amino acid Sequence
putative ABC transporter periplasmic binding protein YcjN Amino Acid Sequence


Size: 430

Fasta

 

>putative ABC transporter periplasmic binding protein YcjN E. coli K12. Version NC_000913.3 GI:556503834
MIKSKIVLLSALVSCALISGCKEENKTNVSIEFMHSSVEQERQAVISKLIARFEKENPGI
TVKQVPVEEDAYNTKVITLSRSGSLPEVIETSHDYAKVMDKEQLIDRKAVATVISNVGEG
AFYDGVLRIVRTEDGSAWTGVPVSAWIGGIWYRKDVLAKAGLEEPKNWQQLLDVAQKLND
PANKKYGIALPTAESVLTEQSFSQFALSNQANVFNAEGKITLDTPEMMQALTYYRDLTAN
TMPGSNDIMEVKDAFMNGTAPMAIYSTYILPAVIKEGDPKNVGFVVPTEKNSAVYGMLTS
LTITAGQKTEETEAAEKFVTFMEQADNIADWVMMSPGAALPVNKAVVTTATWKDNDVIKA
LGELPNQLIGELPNIQVFGAVGDKNFTRMGDVTGSGVVSSMVHNVTVGKADLSTTLQASQ
KKLDELIEQH
              
                            

Download fasta file
RegulonDB