RegulonDB RegulonDB 10.9: Amino acid Sequence
3-dehydro-D-guloside 4-epimerase Amino Acid Sequence


Size: 262

Fasta

 

>3-dehydro-D-guloside 4-epimerase E. coli K12. Version NC_000913.3 GI:556503834
MKIGTQNQAFFPENILEKFRYIKEMGFDGFEIDGKLLVNNIEEVKAAIKETGLPVTTACG
GYDGWIGDFIEERRLNGLKQIERILEALAEVGGKGIVVPAAWGMFTFRLPPMTSPRSLDG
DRKMVSDSLRVLEQVAARTGTVVYLEPLNRYQDHMINTLADARRYIVENDLKHVQIIGDF
YHMNIEEDNLAQALHDNRDLLGHVHIADNHRYQPGSGTLDFHALFEQLRADNYQGYVVYE
GRIRAEDPAQAYRDSLAWLRTC
              
                            

Download fasta file
RegulonDB