RegulonDB RegulonDB 10.9: Amino acid Sequence
kojibiose phosphorylase Amino Acid Sequence


Size: 755

Fasta

 

>kojibiose phosphorylase E. coli K12. Version NC_000913.3 GI:556503834
MTRPVTLSEPHFSQHTLNKYASLMAQGNGYLGLRASHEEDYTRQTRGMYLAGLYHRAGKG
EINELVNLPDVVGMEIAINGEVFSLSHEAWQRELDFASGELRRNVVWRTSNGSGYTIASR
RFVSADQLPLIALEITITPLDADASVLISTGIDATQTNHGRQHLDETQVRVFGQHLMQGS
YTTQDGRSDVAISCCCKVSGDVQQCYTAKERRLLQHTSAQLHAGETMTLQKLVWIDWRDD
RQAALDEWGSASLRQLEMCAQQSYDQLLAASTENWRQWWQKRRITVNGGEAHDQQALDYA
LYHLRIMTPAHDERSSIAAKGLTGEGYKGHVFWDTEVFLLPFHLFSDPTVARSLLRYRWH
NLPGAQEKARRNGWQGALFPWESARSGEEETPEFAAINIRTGLRQKVASAQAEHHLVADI
AWAVIQYWQTTGDESFIAHEGMALLLETAKFWISRAVRVNDRLEIHDVIGPDEYTEHVNN
NAYTSYMARYNVQQALNIARQFGCSDDAFIHRAEMFLKELWMPEIQPDGVLPQDDSFMAK
PAINLAKYKAAAGKQTILLDYSRAEVNEMQILKQADVVMLNYMLPEQFSAASCLANLQFY
EPRTIHDSSLSKAIHGIVAARCGLLTQSYQFWREGTEIDLGADPHSCDDGIHAAATGAIW
LGAIQGFAGVSVRDGELHLNPALPEQWQQLSFPLFWQGCELQVTLDAQRIAIRTSAPVSL
RLNGQLITVAEESVFCLGDFILPFNGTATKHQEDE
              
                            

Download fasta file
RegulonDB