RegulonDB RegulonDB 10.9: Amino acid Sequence
putative ABC transporter ATP-binding protein YcjV Amino Acid Sequence


Size: 322

Fasta

 

>putative ABC transporter ATP-binding protein YcjV E. coli K12. Version NC_000913.3 GI:556503834
MAQLSLQHIQKIYDNQVHVVKDFNLEIADKEFIVFVGPSGCGKSTTLRMIAGLEEISGGD
LLIDGKRMNDVPAKARNIAMVFQNYALYPHMTVYDNMAFGLKMQKIAKEVIDERVNWAAQ
ILGLREYLKRKPGALSGGQRQRVALGRAIVREAGVFLMDEPLSNLDAKLRVQMRAEISKL
HQKLNTTMIYVTHDQTEAMTMATRIVIMKDGIVQQVGAPKTVYNQPANMFVSGFIGSPAM
NFIRGTIDGDKFVTETLKLTIPEEKLAVLKTQESLHKPIVMGIRPEDIHPDAQEENNISA
KISVAELTGAEFMLYTTVGGTS
              
                            

Download fasta file
RegulonDB