RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2534 domain-containing protein YnaJ Amino Acid Sequence


Size: 85

Fasta

 

>DUF2534 domain-containing protein YnaJ E. coli K12. Version NC_000913.3 GI:556503834
MIMAKLKSAKGKKFLFGLLAVFIIAASVVTRATIGGVIEQYNIPLSEWTTSMYVIQSSMI
FVYSLVFTVLLAIPLGIYFLGGEEQ
              
                            

Download fasta file
RegulonDB