RegulonDB RegulonDB 10.9: Amino acid Sequence
p-aminobenzoyl-glutamate hydrolase subunit A Amino Acid Sequence


Size: 436

Fasta

 

>p-aminobenzoyl-glutamate hydrolase subunit A E. coli K12. Version NC_000913.3 GI:556503834
MESLNQFVNSLAPKLSHWRRDFHHYAESGWVEFRTATLVAEELHQLGYSLALGREVVNES
SRMGLPDEFTLQREFERARQQGALAQWIAAFEGGFTGIVATLDTGRPGPVMAFRVDMDAL
DLSEEQDVSHRPYRDGFASCNAGMMHACGHDGHTAIGLGLAHTLKQFESGLHGVIKLIFQ
PAEEGTRGARAMVDAGVVDDVDYFTAVHIGTGVPAGTVVCGSDNFMATTKFDAHFTGTAA
HAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVET
RGASDVINQYVFDRAQQAIQGAATMYGVGVETRLMGAATASSPSPQWVAWLQSQAAQVAG
VNQAIERVEAPAGSEDATLMMARVQQHQGQASYVVFGTQLAAGHHNEKFDFDEQVLAIAV
ETLARTALNFPWTRGI
              
                            

Download fasta file
RegulonDB