RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA endonuclease SmrA Amino Acid Sequence


Size: 187

Fasta

 

>DNA endonuclease SmrA E. coli K12. Version NC_000913.3 GI:556503834
MNLDDKSLFLDAMEDVQPLKRATDVHWHPTRNQRAPQRIDTLQLDNFLTTGFLDIIPLSQ
PLEFRREGLQHGVLDKLRSGKYPQQASLNLLRQPVEECRKMVFSFIQQALADGLRNVLII
HGKGRDDKSHANIVRSYVARWLTEFDDVQAYCTALPHHGGSGACYVALRKTAQAKQENWE
RHAKRSR
              
                            

Download fasta file
RegulonDB