RegulonDB RegulonDB 10.9: Amino acid Sequence
Zn2+:H+ symporter Amino Acid Sequence


Size: 327

Fasta

 

>Zn2+:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP
LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR
QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ
IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE
IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ
FGFSIFCILLVVLIGGVALWLHRSKWL
              
                            

Download fasta file
RegulonDB