RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; DNA-binding transcriptional repressor RacR Amino Acid Sequence


Size: 158

Fasta

 

>Rac prophage; DNA-binding transcriptional repressor RacR E. coli K12. Version NC_000913.3 GI:556503834
MLSGKDLGRAIEQAINKKIASGSVKSKAEVARHFKVQPPSIYDWIKKGSISKDKLPELWR
FFSDVVGPEHWGLNEYPIPTPTNSDTKSELLDINNLYQAASDEIRAIVAFLLSGNATEPD
WVDHDVRAYIAAMEMKVGKYLKALESERKSQNITKTGT
              
                            

Download fasta file
RegulonDB