RegulonDB RegulonDB 11.0: Amino acid Sequence
Rac prophage; toxin YdaS Amino Acid Sequence


Size: 98

Fasta

 

>Rac prophage; toxin YdaS E. coli K12. Version NC_000913.3 GI:556503834
MKKENYSFKQACAVVGGQSAMARLLGVSPPSVNQWIKGVRQLPAERCPAIERATRGEVLC
EELRPDIDWSYLRRSACCSQNMSVKQLNDSNKSSFDHT
              
                            

Download fasta file
RegulonDB