RegulonDB RegulonDB 10.9: Amino acid Sequence
Rac prophage; ParB-like nuclease domain-containing protein YnaK Amino Acid Sequence


Size: 87

Fasta

 

>Rac prophage; ParB-like nuclease domain-containing protein YnaK E. coli K12. Version NC_000913.3 GI:556503834
MSEKLKIVYRPLQELSPYAHNARTHSTEQVAQLVESIKQFGWTNPVLIDEKGEIIAGHGR
VMAAEMLKMDSVPVIVLSGLTDEQKQR
              
                            

Download fasta file
RegulonDB