RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; putative prophage side tail fiber protein StfR Amino Acid Sequence


Size: 1120

Fasta

 

>Rac prophage; putative membrane protein E. coli K12. Version NC_000913.3 GI:556503834
MAVKISGVLKDGTGKPVQNCTIQLKAKRNSTTVVVNTLASENPDEAGRYSMDVEYGQYSV
ILLVEGFPPSHAGTITVYEDSQPGTLNDFLGAMTEDDARPEALRRFELMVEEVARNASAV
AQNTAAAKKSASDASTSAREAATHAADAADSARAASTSAGQAASSAQSASSSAGTASTKA
TEASKSAAAAESSKSAAATSAGAAKTSETNASASLQSAATSASTATTKASEAATSARDAA
ASKEAAKSSETNASSSASSAASSATAAGNSAKAAKTSETNARSSETAAGQSASAAAGSKT
AAASSASAASTSAGQASASATAAGKSAESAASSASTATTKAGEATEQASAAARSASAAKT
SETNAKASETSAESSKTAAASSASSAASSASSASASKDEATRQASAAKSSATTASTKATE
AAGSATAAAQSKSTAESAATRAETAAKRAEDIASAVALEDASTTKKGIVQLSSATNSTSE
TLAATPKAVKSAYDNAEKRLQKDQNGADIPDKGCFLNNINAVSKTDFADKRGMRYVRVNA
PAGATSGKYYPVVVMRSAGSVSELASRVIITTATRTAGDPMNNCEFNGFVMPGGWTDRGR
YAYGMFWQYQNNERAIHSIMMSNKGDDLRSVFYVDGAAFPVFAFIEDGLSISAPGADLVV
NDTTYKFGATNPATECIAADVILDFKSGRGFYESHSLIVNDNLSCKKLFATDEIVARGGN
QIRMIGGEYGALWRNDGAKTYLLLTNQGDVYGGWNTLRPFAIDNATGELVIGTKLSASLN
GNALTATKLQTPRRVSGVEFDGSKDITLTAAHVAAFARRATDTYADADGGVPWNAESGAY
NVTRSGDSYILVNFYTGVGSCRTLQMKAHYRNGGLFYRSSRDGYGFEEDWAEVYTSKNLP
PESYPVGAPIPWPSDTVPSGYALMQGQAFDKSAYPKLAAAYPSGVIPDMRGWTIKGKPAS
GRAVLSQEQDGIKSHTHSASASSTDLGTKTTSSFDYGTKSTNNTGAHTHSVSGSTNSAGA
HTHSLANVNTASANSGAGSASTRLSVVHNQNYATSSAGAHTHSLSGTAASAGAHAHTVGI
GAHTHSVAIGSHGHTITVNAAGNAENTVKNIAFNYIVRLA
              
                            

Download fasta file
RegulonDB