RegulonDB RegulonDB 10.8: Amino acid Sequence
Rac prophage; uncharacterized protein YnaE Amino Acid Sequence


Size: 77

Fasta

 

>Rac prophage; uncharacterized protein YnaE E. coli K12. Version NC_000913.3 GI:556503834
MKSKDTLKWFPAQLPEVRIILGDAVVEVAKQGRPINTRTLLDYIEGNIKKTSWLDNKELL
QTAISVLKDNQNLNGKM
              
                            

Download fasta file
RegulonDB