RegulonDB RegulonDB 10.9: Amino acid Sequence
nucleotide binding filament protein Amino Acid Sequence


Size: 144

Fasta

 

>nucleotide binding filament protein E. coli K12. Version NC_000913.3 GI:556503834
MNRTILVPIDISDSELTQRVISHVEEEAKIDDAEVHFLTVIPSLPYYASLGLAYSAELPA
MDDLKAEAKSQLEEIIKKFKLPTDRVHVHVEEGSPKDRILELAKKIPAHMIIIASHRPDI
TTYLLGSNAAAVVRHAECSVLVVR
              
                            

Download fasta file
RegulonDB