RegulonDB RegulonDB 11.0: Amino acid Sequence
2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase Amino Acid Sequence


Size: 196

Fasta

 

>2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase E. coli K12. Version NC_000913.3 GI:556503834
MPIYQIDGLTPVVPEESFVHPTAVLIGDVILGKGVYVGPNASLRGDFGRIVVKDGANIQD
NCVMHGFPEQDTVVGEDGHIGHSAILHGCIIRRNALVGMNAVVMDGAVIGENSIVGASAF
VKAKAEMPANYLIVGSPAKAIRELSEQELAWKKQGTHEYQVLVTRCKQTLHQVEPLREIE
PGRKRLVFDENLRPKQ
              
                            

Download fasta file
RegulonDB