RegulonDB RegulonDB 10.9: Amino acid Sequence
CDP-alcohol phosphatidyltransferase domain-containing protein YnbA Amino Acid Sequence


Size: 201

Fasta

 

>CDP-alcohol phosphatidyltransferase domain-containing protein YnbA E. coli K12. Version NC_000913.3 GI:556503834
MTLYQIKPLFQSLLRPTMFWLYKHHVTANHITLAALALSLLTGLLLMLAAQPILFLLLPI
VLFIRMALNALDGMLARECNQQTRLGAILNETGDVISDIALYLPFLFLPESNASLVILML
FCTILTEFCGLLAQTINGVRSYAGPFGKSDRALIFGLWGLAVAIYPQWMQWNNLLWSIAS
ILLLWTAINRCRSVLLMSAEI
              
                            

Download fasta file
RegulonDB