RegulonDB RegulonDB 10.9: Amino acid Sequence
putative regulatory protein MokB Amino Acid Sequence


Size: 55

Fasta

 

>putative regulatory protein MokB E. coli K12. Version NC_000913.3 GI:556503834
MNLAIQILASYPPSGKEKGYEAQPSGGVSAHYLHYDSDIHTPDPTNALRTAVPGR
              
                            

Download fasta file
RegulonDB