RegulonDB RegulonDB 10.9: Amino acid Sequence
putative insertion element transposase InsQ Amino Acid Sequence


Size: 382

Fasta

 

>putative insertion element transposase InsQ E. coli K12. Version NC_000913.3 GI:556503834
MRRFAGACRFVFNRALARQNENHEAGNKYIPYGKMASWLVEWKNATETQWLKDSPSQPLQ
QSLKDLERAYKNFFRKRAAFPRFKKRGQNDAFRYPQGVKLDQENSRIFLPKLGWMRYRNS
RQVTGVVKNVTVSQSCGKWYISIQTESEVSTPVHPSASMVGLDAGVAKLATLSDGTVFEP
VNSFQKNQKKLARLQRQLSRKVKFSNNWQKQKRKIQRLHSCIANIRRDYLHKVTTAVSKN
HAMIVIEDLKVSNMSKSAAGTVSQPGRNVRAKSGLNRSILDQGWYEMRRQLAYKQLWRGG
QVLAVPPAYTSQRCAYCGHTAKENRLSQSKFRCQVCGYTANADVNGARNILAAGHAVLAC
GEMVQSGRPLKQEPTEMIQATA
              
                            

Download fasta file
RegulonDB