RegulonDB RegulonDB 10.8: Amino acid Sequence
23S rRNA 5-hydroxycytidine C2501 synthase Amino Acid Sequence


Size: 653

Fasta

 

>23S rRNA 5-hydroxycytidine C2501 synthase E. coli K12. Version NC_000913.3 GI:556503834
MTVSSHRLELLSPARDAAIAREAILHGADAVYIGGPGFGARHNASNSLKDIAELVPFAHR
YGAKIFVTLNTILHDDELEPAQRLITDLYQTGVDALIVQDMGILELDIPPIELHASTQCD
IRTVEKAKFLSDVGFTQIVLARELNLDQIRAIHQATDATIEFFIHGALCVAYSGQCYISH
AQTGRSANRGDCSQACRLPYTLKDDQGRVVSYEKHLLSMKDNDQTANLGALIDAGVRSFK
IEGRYKDMSYVKNITAHYRQMLDAIIEERGDLARASSGRTEHFFVPSTEKTFHRGSTDYF
VNARKGDIGAFDSPKFIGLPVGEVVKVAKDHLDVAVTEPLANGDGLNVLIKREVVGFRAN
TVEKTGENQYRVWPNEMPADLHKIRPHHPLNRNLDHNWQQALTKTSSERRVAVDIELGGW
QEQLILTLTSEEGVSITHTLDGQFDEANNAEKAMNNLKDGLAKLGQTLYYARDVQINLPG
ALFVPNSLLNQFRREAADMLDAARLASYQRGSRKPVADPAPVYPQTHLSFLANVYNQKAR
EFYHRYGVQLIDAAYEAHEEKGEVPVMITKHCLRFAFNLCPKQAKGNIKSWKATPMQLVN
GDEVLTLKFDCRPCEMHVIGKIKNHILKMPLPGSVVASVSPDELLKTLPKRKG
              
                            

Download fasta file
RegulonDB