RegulonDB RegulonDB 10.9: Amino acid Sequence
antitoxin of the HicA-HicB toxin-antitoxin system / DNA-binding transcriptional repressor HicB Amino Acid Sequence


Size: 138

Fasta

 

>antitoxin of the HicA-HicB toxin-antitoxin system /  DNA-binding transcriptional repressor HicB E. coli K12. Version NC_000913.3 GI:556503834
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLP
SPLNSHDHFIEVPLSVASKVLLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKID
AVQLAAKALGKELSLVMV
              
                            

Download fasta file
RegulonDB