RegulonDB RegulonDB 11.0: Amino acid Sequence
putative ABC transporter membrane subunit YdcU Amino Acid Sequence


Size: 313

Fasta

 

>putative ABC transporter membrane subunit YdcU E. coli K12. Version NC_000913.3 GI:556503834
MAMNVLQSPSRPGLGKVSGFFWHNPGLGLFLLLLGPLMWFGIVYFGSLLTLLWQGFYTFD
DFTMSVTPELTLANIRALFNPANYDIILRTLTMAVAVTIASAILAFPMAWYMARYTSGKM
KAFFYIAVMLPMWASYIVKAYAWTLLLAKDGVAQWFLQHLGLEPLLTAFLTLPAVGGNTL
STSGLGRFLVFLYIWLPFMILPVQAALERLPPSLLQASADLGARPRQTFRYVVLPLAIPG
IAAGSIFTFSLTLGDFIVPQLVGPPGYFIGNMVYSQQGAIGNMPMAAAFTLVPIILIALY
LAFVKRLGAFDAL
              
                            

Download fasta file
RegulonDB